SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001310 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001310
Domain Number 1 Region: 442-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-25
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily RING/U-box 8.52e-22
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-20
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.85e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001310
Domain Number - Region: 381-431
Classification Level Classification E-value
Superfamily ARM repeat 0.00748
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001310   Gene: ENSSSCG00000001233   Transcript: ENSSSCT00000001341
Sequence length 545
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:24795834:24820308:1 gene:ENSSSCG00000001233 transcript:ENSSSCT00000001341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDIHPVSGGRPVCPLCKKPF
TKENIRPVWQLASLVENIERLKVDTGRQPGEVAREQQDTRLCERHQEKLHYYCEDDGKLL
CVMCRESREHRPHTAVLVEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAELKK
LQDQRQRILAAFEQGHQFLWEREQHLLDQLAKLEQEVTEGREKYKTRGVGELARLAQVIS
ELEGKAQQPAAELMQDTRDFLTRYPRKKFWIGKPIARVVKKRTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYSGLYQSSYLHPQQFECEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGAGFGYGDGYDDWGTDE
DEESLGDEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANT
RPEAELFPAQRPRRVGIALDYEGGTVTFTNAESQELIYTFKATFTRRLLPFLWLRWPGTR
LLLRP
Download sequence
Identical sequences 9823.ENSSSCP00000001310 ENSSSCP00000001310 ENSSSCP00000001310 ENSSSCP00000028578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]