SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001312 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001312
Domain Number 1 Region: 309-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-46
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 8-82
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-18
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 96-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000153
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001312
Domain Number - Region: 130-205
Classification Level Classification E-value
Superfamily STAT 0.0294
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001312   Gene: ENSSSCG00000001234   Transcript: ENSSSCT00000001343
Sequence length 482
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:24847442:24857632:1 gene:ENSSSCG00000001234 transcript:ENSSSCT00000001343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAASVSSLADEVNCPICQGTLREPVTIDCGHNFCCVCLTRYLEIPCLDPGELPTCPLC
KEPFRPGSFRPNWQLASVVENIERLKLGSQLGLEEEEDVCLEHREKVYYFCEDDEMQLCV
VCREAWEHRHHTVRFLEDAAGPYREQIQKCLECLRKEGEEIQRIQLRENQRIQVLLTQVA
TKKQKVISEFAHLSQFLEEQQSVLLAQLERLDGDILKHRDEFDVLVAGEICRFNTLIEEL
EEKNQRPARDLLTDIRSTLIRCETRRCRKPEAVSPELGQRIRDFPQQALPLRREMKTFLE
KLCFELDYEPAHISLDPQTSHPKLLLSEDNQQARFSYKWQNSPDNPQRFDRATCVLAHSG
FTEGRHTWVVSVDLAHGGSCTVGVVSQDIRRKGELRMRPEEGVWAVRLAWGFVSALGSFP
TRLALEEHPRQVRVSIDYEVGWVTFVNAVTQEPIYTFTASFTQKVFPFFGLWGRGSKFSL
SS
Download sequence
Identical sequences ENSSSCP00000001312 ENSSSCP00000001312 XP_013833001.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]