SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001314 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001314
Domain Number 1 Region: 292-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-49
Family SPRY domain 0.0000456
Further Details:      
 
Domain Number 2 Region: 67-132
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 8-68
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000221
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001314   Gene: ENSSSCG00000001235   Transcript: ENSSSCT00000001345
Sequence length 461
Comment pep:known chromosome:Sscrofa10.2:7:24833171:24844895:-1 gene:ENSSSCG00000001235 transcript:ENSSSCT00000001345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTPSHKGAVCSDCQGRLEDAVTAACGHTFCRLCLPLPPQMGAQPSSRVLLCPVCQEKE
QTEPVLVPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPSHQAHAVGFLDEAIQ
PYRDRLRGRLEALITERDEIEDMKSREDQKLQVLLAQIESKKRHVEATFERLQQELGEQQ
RLLLARLTELERQIWKERDKYISKLSEEVARLGTQVKELEEKCQQPASELLQDVRVNQSR
CETKTFVSPEAISPDLVKKIRDLHRKILTLPEMLRAFSENLVHHLETDSGIVTLDPLTAS
PSLVLSEDRKSVRYTRQKQNLPDSPLRFEGLPVVLGSPGFSSGRHRWQVEVQLGEGGGCT
VGVVGEEVRRKGEQGLSAEEGVWAVILSHQQCWASTSPGTDLPLSEIPRRVGVALDYEAG
RVALLNAETRAPIFTFAASFSGKVFPFFAVWKKGSCLTLKG
Download sequence
Identical sequences B6ICV0 Q9TSW0
NP_001116680.1.46622 ENSSSCP00000001314 ENSSSCP00000001314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]