SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001317 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001317
Domain Number 1 Region: 395-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-38
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-20
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 89-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000198
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001317
Domain Number - Region: 185-297
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00719
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001317   Gene: ENSSSCG00000028173   Transcript: ENSSSCT00000001348
Sequence length 576
Comment pep:known chromosome:Sscrofa10.2:7:25106145:25119609:1 gene:ENSSSCG00000028173 transcript:ENSSSCT00000001348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQFTNKLQEEVICPICMDILQDPATIDCGHSFCLQCIMRSREGLDSVIKCPLCNKIV
KRDTIRPNWLLVNLVEKIQAMDPSEEQPEVKELKCPKHGERFHYFCESDGKVLCVACCGS
KDHKFHNTILLEEAAQSFQGQIQSQVEALLQKERAIVQMKLQGDQRITTLMAQVEQEKQK
ISTVFEQLLQALKEEKNFLLSRINWLDQELTKDRNSYLASAEAQLQSLRKLKDSLKARQL
LPPREMLQDIKPVLSRSAGFRFLSPPPVSADLEKKLNETKLRHESLIESLKKFQDKCQAD
GKKDKSRFLKGLDKHYIKSWYLLEKSNPTPMETLEPELSPSDDRNAKPLPPKLKLSPSLP
NLFRSRSRASIASFVFYSNEDSSEDPGSPGAAWTEELKAALTPVTLDAASAHPDLIISQD
LKTVTLDPVPQSRCAEPTDPARFHPFRCVLGLPGLSSGCQTWEAELEGPEGGGCLVGVAS
ELVTRRGPLMIEPLTGFWVLRIVGFDCQALTEGGTREELSVRPRKVGVHVNHEGGEVVFY
DSITSSRIYTFHTSFPGQVLPFFRLLFPGTQITLSP
Download sequence
Identical sequences B6ICU7
ENSSSCP00000001317 ENSSSCP00000001317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]