SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001327 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001327
Domain Number 1 Region: 210-405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-37
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 69-138
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000808
Family RING finger domain, C3HC4 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001327   Gene: ENSSSCG00000001244   Transcript: ENSSSCT00000001358
Sequence length 408
Comment pep:known chromosome:Sscrofa10.2:7:24985582:24990520:1 gene:ENSSSCG00000001244 transcript:ENSSSCT00000001358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLKREAIPGEGQKTKVNAGGGERGINATSSRGAQPAARSKAFAGVAEGTAPRRWLPMEAP
ELLGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARCWGTPPATGPETPPTAC
PCCGLPCPRRCLRSNVRLAVEVRISRGLREKLAEPGARTGKRRGGRIPTMGCLDQQGEDM
RKTWRRFDAPTPRSSNSEDELPEDYPVVKNMLHRLTADLTLDPGTAHRRLLVSADRRSVR
LAPPGTPVPPDGPARFDQLPAVLGAQGFGAGRHCWEVETADAASGDSSGEDEDDGESLYA
VGAAGESVRRKGRVGLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAGPPPRRIRVDLDWE
RGRVAFYDGHSLDLLFAFQGPGPLGERVFPLLCTRDRRAPLRIVPAEG
Download sequence
Identical sequences ENSSSCP00000001327 ENSSSCP00000001327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]