SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001521 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001521
Domain Number 1 Region: 456-745
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-53
Family Eukaryotic proteases 0.0000162
Further Details:      
 
Domain Number 2 Region: 188-456
Classification Level Classification E-value
Superfamily vWA-like 1.13e-50
Family Integrin A (or I) domain 0.0000148
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 5 Region: 23-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001521   Gene: ENSSSCG00000001422   Transcript: ENSSSCT00000001563
Sequence length 752
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:27778160:27791677:-1 gene:ENSSSCG00000001422 transcript:ENSSSCT00000001563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMVVLCLLPLYPGLATAAPSCPQNVNISGGSFTLSNGWAPGSILTYSCPLGYYPFPV
ASRLCNSNGQWQIPRATRSTKPVCKPVRCPAPVSFENGVYTPRLGSHPVGGNLTFECEDG
FTLRGSPVRQCRPNGMWDGETAVCDNGASHCPDPGISVGAVRTGSRFGPGDKVRYRCSSN
LVLTGSMERECQDNGVWSGTEPICRQPYSYDFPEDVTPALGTSFSHLLGATNPTQTKKTE
NVGRKIQIQRSGHLNLYLLLDASQSVSEEDFGVFKRSASLLVDRIFSFEINISVAIITFA
SKPKIIMSVLKDKSRDVTEVVHSLENINYKDHENGTGTNIYEALNSVYIMMNNQMQNLGM
NTMAWQEIRHAIILLTDGKSNMGGSPKPAVDNIKEILNIKEKRKDYLDIYAIGVGNVEVD
WRELNELGSKKDGERHAFILKDTEALSQVFEHMLDVSQLTDTICGVGNMSANASAQERTP
WHVTIKPKSHETCRGALISDQWVLTAAHCFSHSEDHSLWRVSVGDPNSQWGKEFRIEKAV
ISSEFNVSAKKHQGIPEFYGDDIALLKLDQKVKMSTHARPICLPCTVGANLALRRHPGST
CRDHEKELLNQLSVPAHFVALNGSKLNVHLKTGSDWTSCIQAVSQDKVTFPNLTNVREVV
TDQFLCSGTKEDDNPCKGESGGSVFLERRFRFFQVGLVSWGLYSPCSSSNKNLRKKAPRG
RIPPPRDFHINLFRLQPWLRQHLEGILNFLPL
Download sequence
Identical sequences ENSSSCP00000001521 ENSSSCP00000001521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]