SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001522 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001522
Domain Number 1 Region: 203-471
Classification Level Classification E-value
Superfamily vWA-like 9.64e-58
Family Integrin A (or I) domain 0.000000017
Further Details:      
 
Domain Number 2 Region: 474-759
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.03e-57
Family Eukaryotic proteases 0.00000000125
Further Details:      
 
Domain Number 3 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000393
Family Complement control module/SCR domain 0.0000331
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0000299
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000653
Family Complement control module/SCR domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001522   Gene: ENSSSCG00000024914   Transcript: ENSSSCT00000001564
Sequence length 765
Comment pep:known chromosome:Sscrofa10.2:7:27771732:27777630:-1 gene:ENSSSCG00000024914 transcript:ENSSSCT00000001564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNRCPRLGLVPLILGLLSGGVSMTPLPEARPQSPCSLEGIEIKGGTFHLLKEGLVLEY
VCPSGFYPYPVQIRTCRSSGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPRAAY
YNLSDEISFHCYDGYTLRGSANRTCQVTGRWDGQTAICDDGAGYCPNPGIPIGTRKVGTQ
YRLEDSVTYYCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTE
TIEGVDAEDGHIPGDQQKRKIVLDPSGSMNIYLVLDGSDSIGARNFTGAKNCLKDFIEKV
ASYGVKPKYGLVTYATDPKVLIRVSNPKSADADWVTEQLDKISYDDHKLKAGTNTKKALL
EVYNMMSWGVNNFPDNWNRTRHVIVLLTDGLHNMGGDPVTVIHDIRDLLNIGRNRKNPRE
DYLDIYVFGVGPLVNQENINALASKKDKEQHVFKLKDVDNLEDVFFQMLDESRSLGLCGM
VWEHKDGTDYHKQPWHAKISITRPSKGHESCMGAVVSEYFVLTAAHCFTVDDEKHSIKVS
LGGKKQEWEIDQVLFHPNYDLNAKTAKDIPEFYDYDVALIRLSKKLKYDQTIRPICLPCT
EGSNQALRLPLTTTCQQQMQELLPAKDVKALFVSELTKDHRKILTRKEVYIKNGERKAAC
ERDALQAQGYEKVKVVSEVVTPRFLCTGGVIPYADPNTCKGDSGGPLIIHKKSRFIQVGV
ISWGVVDICKRQQQAPSYARDFHINLYKVLPWLKEKLKDEDLGFL
Download sequence
Identical sequences F1RQW6
ENSSSCP00000001522 ENSSSCP00000001522 XP_020953515.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]