SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001598 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001598
Domain Number 1 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-39
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001598   Gene: ENSSSCG00000001473   Transcript: ENSSSCT00000001640
Sequence length 1618
Comment pep:novel chromosome:Sscrofa10.2:7:29768988:29798122:1 gene:ENSSSCG00000001473 transcript:ENSSSCT00000001640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCSRCHRLLLLVPLVLGLSAAPAWAGASPVDVLRALRFPSLPDGVRRTRGICPADVAY
RVSRPAQLSAPTRQLFPGGFPKDFSLLTAVRTRPGLQAPLLTLYSAQGVRQLGLELGRPI
RFLYEDQTGRPQPPAQPVFRGLSLADGKWHRVAVAVKGQSVTLILDCKKRVTRPLPRSAH
PVLDTHGVIIFGARILDEEVFEGDVQELVIIPGVQAAYESCEQKELDCEGGWRETPLKQQ
SHRTQRSPKQQPPRLHRPQNQEPQRQDPTPGGEEGILESSPLPPPEEAARGPRGLKGEKG
EPAVLEPGMLVEGPPGPEGPAGLTGPRGIQGNPGPVGDPGERGPPGRAGLPGSDGAPGPP
GTSLMLPFRFGSGAGDKGPVVAAQEAQAQAILQQARLALRGPPGPMGYTGRPGPLGQPGS
PGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGVKGDRGFDGLPGL
PGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIPGPPGP
QGEPGPPGQQGTPGTQGLPGPQGAVGPHGEKGPQGKPGLPGMPGSDGPPGHPGKEGPPGT
KGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGEDGFPGFKGDMGVKGDRGEVGV
PGSRGEDGPEGPKGRTGPTGDPGPPGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGA
SGEKGARGLSGKPGPRGERGPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGP
QGPNGFPGPKGPPGPPGKDGLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGAAGETGPMGE
RGHPGPPGPPGEQGLTGTAGKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGL
KGNEGPAGPPGPAGSPGERGAAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGR
DGVQGPVGLPGPAGPPGVAGEDGDKGEVGDPGQKGAKGNKGEHGPPGPPGPLGPVGQPGA
AGADGEPGARGPQGHFGAKGDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGP
PGPRGPAGPNGADGPQGPSGGVGNLGPPGEKGEPGESGSPGVQGEPGVKGPRGERGEKGE
SGQPGEVGPPGPKGPTGDDGPKGNPGPVGFPGDPGPPGEAGPRGQDGAKGDRGEDGEPGQ
PGSPGPTGENGPPGPLGKRGDPGAVGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGR
PGATGQAGPPGPVGPPGLPGLRGDTGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGS
TGQKGETGIPGASGPIGPGGPPGLPGPAGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGE
VIQPLPIQMPKKTRRSVDGSRLMQEDEAMPTGGAPGSPGGLEEIFGSLDSLREEIEQMRR
PTGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDV
TQFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSSGEDQDGPLKLRGANEDELSPET
SPYVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSDLGAPPRRGGVLLGPVCFMG
Download sequence
Identical sequences ENSSSCP00000001598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]