SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001614 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001614
Domain Number 1 Region: 161-473
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.93e-41
Family Papain-like 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001614
Domain Number - Region: 93-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.000146
Family VWC domain 0.064
Further Details:      
 
Domain Number - Region: 74-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000719
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001614   Gene: ENSSSCG00000001484   Transcript: ENSSSCT00000001656
Sequence length 482
Comment pep:novel chromosome:Sscrofa10.2:7:30957928:31029802:1 gene:ENSSSCG00000001484 transcript:ENSSSCT00000001656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGSMLLILAYLTTGVWMKRQSLSHREVDPRADFTRNHTILEGTRFKRAIFRGQYCRSF
GCCEDRDDSCVTPFYEANAVCYCDKFCERENSDCCPDYQSFCREEKEWRPHTKPWYPEGC
HRDGQHYEEGSVIKENCNSCTCSGQQWNCSQHVCLVQPGLIEHVNEGDFGWTAQNYSQFW
GMTLEEGFKYRLGTLPPSPLLLSMNEVTASLPETTDLPEFFVASYKWPGWTHGPLDQKNC
AASWAFSTASNKVILDKIKKRKRKKYTHIETIMQTNKIQAIQKKEHGKHSGALLASALYY
KKKKLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNFEKSNRIYQCSPPYR
VSSNETEIMREIMQNGPVQGAVFQNLESFSHYFKVVFQRLKQTNKNSERKHIIYYTHSIY
IFRWGTLKGAQGRKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTNSD
EP
Download sequence
Identical sequences ENSSSCP00000023107 ENSSSCP00000001614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]