SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001629 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001629
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 4.97e-56
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 231-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.8e-27
Family Laminin G-like module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001629   Gene: ENSSSCG00000001500   Transcript: ENSSSCT00000001673
Sequence length 476
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:33918801:34009970:1 gene:ENSSSCG00000001500 transcript:ENSSSCT00000001673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQITFLRMVLVLLLQNSVLAEDGEIRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNITKNFDIGPKFIQVGVVQYSDYPVLEIPLGRHESGEKLLAAVGSIHYLGGNTRTGKAI
QFALDYLFAKSSRFLTKIAVVLTDGKSQDEVKDAAEAARDSKITLFAIGVGSETEDAELR
AIANKPSSTYVFHVEDYIAISKIREVMKQKLCEESVCPTRIPVAARDEKGFDILLGLGVK
KKAKKRIQLSPTKIKGYEVTSKVDLSESTSNVFPEGLPPSYVFVSTQRFKVKKMWDLWRI
LTMDGRPQIAVTLNGVDKTLLFTTTSVINGSQVVTFADPRVKTLYDEGWHQIRLLVTEQD
VTLYIDDQQIENKPLHPVLGIFISGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFNGECLNGPSDVGSTEAPCICPPGKPGLQGRKGDPGQPGNPGYPGQPGQDG
Download sequence
Identical sequences ENSSSCP00000001629 ENSSSCP00000001629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]