SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001667 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001667
Domain Number 1 Region: 869-977
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-22
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 93-223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.65e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 341-464
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.19e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 8-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.22e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 245-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000738
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 686-828
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000971
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001667   Gene: ENSSSCG00000001536   Transcript: ENSSSCT00000001711
Sequence length 1054
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:35854337:36008752:-1 gene:ENSSSCG00000001536 transcript:ENSSSCT00000001711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLPLPDVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAG
CVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECVEGTDNCHIDAICQNTPRSYKCICK
SGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAE
GTGGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKG
GIACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDGKTCIE
TCAVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGS
FECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHHGYLLYGVTHCGDV
DECSINRGGCRFGCINTPGSYQCTCPGQGRLHWNGKDCAEPVKCQSSPVASRATLSCNRS
GKKDTCALTCPSRARFLPESENGFTVSCGIPSPRAAPARAGHAGNSTNSNHCLEAAVLTV
KQRASFKIKDAKCRLHLRNKGKTEEASRILVPGGAPCSDCQVTFIHLKCDSSRKGKGRRA
RTPPGKEVTRLTLELEAEVRAEESTAGCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLR
LAGLDYELAHKPGPVAGERAEPVEACRPGQHRSGAKCVSCPQGTYYHGQTEQCVPCPAGT
FQEREGQLSCDLCPGSDAHGPLGATNITTCAGQCSPGQHSVDGFKPCQPCPRGTYQPEAG
RTLCFPCGGGLTTKHEGAVSFQDCDTKVQCSPGHYYNTSIHRCIRCAVGSYQPDFRQNFC
TRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECVWNINPPPK
RKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFK
TSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHP
QNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences ENSSSCP00000001667 ENSSSCP00000001667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]