SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001705 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001705
Domain Number 1 Region: 25-180
Classification Level Classification E-value
Superfamily PR-1-like 2.62e-52
Family PR-1-like 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001705
Domain Number - Region: 180-199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0903
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001705   Gene: ENSSSCG00000001570   Transcript: ENSSSCT00000001749
Sequence length 461
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:37504337:37514234:1 gene:ENSSSCG00000001570 transcript:ENSSSCT00000001749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSRSLQALLLPPLLLLAAATGPAGALSDNEKHVMVELHNFYRAQVTPPAANMLQMRWD
EELAAFAKAYAQQCVWGHNKERGRRGENLFAITDKGLDVPLAMEEWYHEWEHYNLSAATC
AAGQMCGHYTQVVWAKTERIGCGAHLCEKLQGIEEANIHLLVCNYKPPGNMKGQRPYQEG
TPCSQCPSGYRCENSLCEPIRGPEESQHLPYLVYEAPSSLTTEASGSREKGTTSSLAMET
PSLVKEVSGSLATEALPAVETKAPSSLVTEDSPSMATEAPPSLTTEAPFFLATHNLLSLD
ERSATFPKSTQDPTPKSADQEASSTRMPSRSPESSLHPKTSFTGTQEPLHPSQEGEAEAE
SPDSSEILASVFLAQDQAGEPQATLEHKGHTSSKPLSNSPAASATAKATGGRTLALQSSL
PGAEDPERPGIESGLNSSPRHIGGLFLGLLLLPALLLAGIF
Download sequence
Identical sequences 9823.ENSSSCP00000001705 ENSSSCP00000001705 NP_001230456.1.46622 ENSSSCP00000001705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]