SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001766 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001766
Domain Number 1 Region: 240-281,337-649
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000282
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily RING/U-box 1.29e-27
Family Zf-UBP 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001766   Gene: ENSSSCG00000001629   Transcript: ENSSSCT00000001812
Sequence length 682
Comment pep:known chromosome:Sscrofa10.2:7:42213781:42224175:1 gene:ENSSSCG00000001629 transcript:ENSSSCT00000001812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRCKHVGRLRLAQDHSILNPQKWCCRECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQTQDLPLRRGRTLRSM
ASGEDAVPPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRREEALER
KKEAARQRRREVKRRLLEELASAPPRKSARLLLHAPRAAAPRAPAPRAPAGPRPVPRRAP
AMAPGVTGLRNLGNTCYMNSILQVLSHLRKFRECFLNLDPSKTEQLFPRAANGKAPLTGR
LASSSATELSPRSDGAETCEREGLCLNGGASLSRSLELIQNKEPSSKHISLCHELHTLFR
VMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGTTRRILI
PFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYHCIEKGF
VPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRLP
QVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDLSAVVMH
HGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNARFS
ETQLQTQVQSSNNNEGRPRTFP
Download sequence
Identical sequences F1RUW2
ENSSSCP00000001766 ENSSSCP00000001766 XP_020954336.1.46622 XP_020954337.1.46622 XP_020954338.1.46622 XP_020954339.1.46622 XP_020954340.1.46622 XP_020954341.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]