SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001881 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001881
Domain Number 1 Region: 99-285
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.69e-50
Family Astacin 0.00019
Further Details:      
 
Domain Number 2 Region: 456-629
Classification Level Classification E-value
Superfamily TRAF domain-like 7.03e-38
Family MATH domain 0.00081
Further Details:      
 
Domain Number 3 Region: 293-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-29
Family MAM domain 0.0048
Further Details:      
 
Domain Number 4 Region: 701-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000194
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001881   Gene: ENSSSCG00000001724   Transcript: ENSSSCT00000001928
Sequence length 774
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:48248970:48286177:1 gene:ENSSSCG00000001724 transcript:ENSSSCT00000001928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWTRSPCILSFILFFAHIAAVSVSRVLLLYLETLILVYIIHFLYIYFQIKHLSKGNVHD
GDFDEQKDITEINLDAGLDLFQGDILLQNSRNGLRDPNTRWKFPIPYILANNLALNAKGA
ILYAFEMFRLKSCVDFKPYEGESSYIIFQKFDGCWSEVGDQHVGQNLSIGQGCDYKAIIE
HEILHALGFYHEQSRTDRDDYVNIWWDEILPGYQHNFNTYDDNFITDLNTPYDYESLMHY
GPFSFNKNDSVPTITTKIPEFNTIIGQRLDFSEVDLERLNRMYNCTTTHTFLDHCAFEKA
NICGMIQGTRDDADWVHEDSAQPGQVDHTLGGQCTGAGYFMHFDTSSGAVEEAALLESRI
LYPKRKQQCLQFFYKMTGSSSDRLVVWVRRDDGTGNVRKLVKMKTFQGDFDQNWKIAHVP
LREEKKFRYLFQGTKGDPQNSNGGIYLDDVTLTETPCPTGVWTVRNFSQVLQDTVQGDKL
QSPRFYSSEGYGLGLTLYPHGGMNSEHSEYVGLAFHLCSGENDAVLEWPVENRQVIMTIL
DQEPDVRKRMSSSMVFTTSKSQTSAAINGSVIWDRPSIVGSYHNSCDCFRTIDWGWSGVI
SHQMLKRKSFLKNDDLILFVDFEDITHLNQTEVDVKDSRLTPRGLILQGQEQQVSEEASR
KASLEKALLESPAQGHSGRQKRSVDNTGPLEDPTWPQYFRDPCDPNPCQNEGICVNVKGM
ASCRCVSSRAFFYTGERCQAMQVHGSILGLMLGGAASLILSFTIVSILHQRPRQ
Download sequence
Identical sequences ENSSSCP00000001881 ENSSSCP00000020506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]