SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001925 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001925
Domain Number 1 Region: 101-157
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000034
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 509-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 1111-1170
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1000-1063
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 5 Region: 387-444
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 1061-1112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000379
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 955-1005
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000994
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 8 Region: 442-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001925   Gene: ENSSSCG00000001765   Transcript: ENSSSCT00000001974
Sequence length 1228
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:53451724:53469404:1 gene:ENSSSCG00000001765 transcript:ENSSSCT00000001974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSHLCSRGWGLCLDDSPAKDVIDFPSVPPGVLYDVGHQCRLQYGAYSAFCDDMDNVCHTL
WCSVGTTCHSKLDAAVDGTRCGESKWCLNGECVPVGFRPEAVHGGWSGWSAWSVCSRSCG
VGVQSAERQCTQPAPKYKGKYCVGERKRFRLCNLQACPAGRPSFRQVQCSHFDAMLYKGQ
LHTWVPVVNDVNPCELHCRPSNEYFAEKLRDAVIDGTPCYQGQASRDLCINGICKNVGCD
FEIDSGAVEDRCGVCHGNGSTCHTVSGTFEEAEGLGYVDVGLIPAGAREIRIEEVAEAAN
FLALRGEDPDKYFLNGGWTIQWNGDYQVAGTTFTYARTGNWENLTSPGPTDEPVWIQLLF
QESNPGVRYEYTIHREADGHGHIQPPEFSWHYGPWTKCTVTCGTGMQRQSVHCTERQAGP
VDERHCDPLDRPDDRQRKCSEEPCPARWWAGEWQLCSRSCGPGGFSRRAVLCIRSVGLDE
QSALEPPACEHLPRPPAETPCNRDVPCPATWAVGNWSQCSVTCGPGTQHRSILCTNDTGV
PCDEAQRPASEAACLLPPCLQAVDTPGPEGSGSGSSSHELFNEVDFIPRRPAPRPLPPSP
PEPAGMGNAIGEEDPKMGLPGPVFVDDFYYDYNFINFHEDLSYGIFEEPDTDLTGDWMPP
PLSSPPEPPTGTPVPATEPPGAEKEGAVPGPRWAGHSPPPPSEQTPGNPQLNFLSEEDAP
IGAPDPGLPSLLWPPTPVSLETPMPPGNQTSFPGGEHSQGQPPLPPPQGERTNEVSEDND
EATGHKAPYLPQKPSPTSPSLPSISTTHSSGPNMVELWTGKVVAWDPALDSGLGPQPPPT
AALPDTWGTDSPLEPGSPTLSTPRMALQDLQTGAVPGTFLRTAPTGLGNTPWVTALSPGP
LGQPESPNSDESPGPVLLSIPAQDSLANSSRAPAPLVPSPTEAEAPVYLPAARNASWEVG
NWSKCSTTCGLGAVWRPVRCSSGREEDCIPAGRPQPARRCHLRPCAAWHTGNWSKCSRSC
GGGSSTRDVQCVDTRDFRPLRPFHCQPGPAKPPARRPCGAQPCLSWYTSSWRECSEACGG
GEQQRLVTCPEPGLCEEALRPNSTRPCNTHPCTQWVVGPWGQCSAPCGGGVQRRLVKCVN
TQSGLPEEDSDQCGHEAWPESSRPCGIQDCELTELPRCERDRLSFGFCETLRLLGRCQLP
TVRSQCCRSCPLPGHGAPSRGHQRVARR
Download sequence
Identical sequences ENSSSCP00000001925 ENSSSCP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]