SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001934 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001934
Domain Number 1 Region: 33-333
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.41e-111
Family Papain-like 0.000000000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001934   Gene: ENSSSCG00000001770   Transcript: ENSSSCT00000001983
Sequence length 335
Comment pep:known chromosome:Sscrofa10.2:7:53623062:53644262:-1 gene:ENSSSCG00000001770 transcript:ENSSSCT00000001983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAVLSLLCAGAWLLGPPACGASNLAVSSFEKLHFKSWMVQHQKKYSLEEYHHRLQVFVS
NWRKINAHNAGNHTFKLGLNQFSDMSFDEIRHKYLWSEPQNCSATKGNYLRGTGPYPPSM
DWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHG
CQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMV
EAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVK
NSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Download sequence
Identical sequences B2D1T2 O46427
ENSSSCP00000001934 NP_999094.1.46622 9823.ENSSSCP00000001934 ENSSSCP00000001934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]