SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001936 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001936
Domain Number 1 Region: 33-137
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.5e-26
Family Papain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001936   Gene: ENSSSCG00000001770   Transcript: ENSSSCT00000001985
Sequence length 197
Comment pep:known chromosome:Sscrofa10.2:7:53623062:53644262:-1 gene:ENSSSCG00000001770 transcript:ENSSSCT00000001985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAVLSLLCAGAWLLGPPACGASNLAVSSFEKLHFKSWMVQHQKKYSLEEYHHRLQVFVS
NWRKINAHNAGNHTFKLGLNQFSDMSFDEIRHKYLWSEPQNCSATKGNYLRGTGPYPPSM
DWRKKGNFVSPVKNQNSSWWTAPRTSTITAAKGVSPARPSSTSATTRASWVKTPTRTRAR
MITASSSPIRPLLLSRM
Download sequence
Identical sequences ENSSSCP00000001936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]