SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001947 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001947
Domain Number 1 Region: 56-140
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 138-201
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000982
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001947   Gene: ENSSSCG00000001781   Transcript: ENSSSCT00000001996
Sequence length 208
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:54813733:54837749:1 gene:ENSSSCG00000001781 transcript:ENSSSCT00000001996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS
EIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYK
PSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHP
DDVEKLREQLCTSENSMTGQCCSVKLLD
Download sequence
Identical sequences ENSSSCP00000001947 ENSSSCP00000001947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]