SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001973 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001973
Domain Number 1 Region: 569-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.13e-41
Family SPRY domain 0.00067
Further Details:      
 
Domain Number 2 Region: 374-566
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-23
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001973
Domain Number - Region: 175-224
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000427
Family B-box zinc-binding domain 0.0044
Further Details:      
 
Domain Number - Region: 192-316
Classification Level Classification E-value
Superfamily Tropomyosin 0.0386
Family Tropomyosin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001973   Gene: ENSSSCG00000001806   Transcript: ENSSSCT00000002022
Sequence length 752
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:57653600:57679877:1 gene:ENSSSCG00000001806 transcript:ENSSSCT00000002022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEAGEAPGLGRPAAPKDFHFYHVDLYDSEDRLQIFPEGNARMRREVVQAEMTNEPRAA
VKGKAPRDLEEEVDELVHLYGLEDDHELGDAFVDESMPRIEVSEYPPYGMTGREAAREQR
DWRLSGEEANAEDLGLGGWGSADQCQDLREAYRYTHGRASEEYECYVIPEEEDEDEAADV
FCVTCKTPVRALEVSDEHKEHEVTPLHKALESAKDEIHKNMYKLEKQIIEMENFASHLEE
VFITVEENFGRQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENL
DTCKELMETIEEMCHEEKVDFIKDAVAMADRFPVSAFVPHEYVIKSEEFKSCYPHELGFS
DVEQLMDSLNTIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVRDSSP
EKDQAEFTMTIKETYCSVTNLVPNTQYEFWVTARNRAGLSPASERAVYMTAPSPPTIKSR
EIRSCEEAALICWESGNLNPVDSYTVELSQAEAPGASGVTESVVGIPTCECLVQLQPRQS
YIIYVRALNVGGPSARSQPATVHTTGSYFHLNEHTCHPWLTISEDGLTVVRSERRAPASE
LLSSDTRFTRCVAVMGNLIPVRGRHYWEVEVDECLDYTVGVAFEDVPKQEDLGANHLSWC
MRHTFASSRHKYEFLHNKTTPDIRITVSPKKIGILLDYENSKLSFFNVGLSQHLYTFSCQ
LHQFVHPCFSLEKPGCLKIHNGISMPKHVTFY
Download sequence
Identical sequences 9823.ENSSSCP00000001973 ENSSSCP00000001973 ENSSSCP00000001973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]