SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001982 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001982
Domain Number 1 Region: 424-732
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.34e-104
Family PDEase 0.00000276
Further Details:      
 
Domain Number 2 Region: 165-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000174
Family Heme-binding PAS domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001982
Domain Number - Region: 31-105
Classification Level Classification E-value
Superfamily CheY-like 0.000536
Family CheY-related 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001982   Gene: ENSSSCG00000001810   Transcript: ENSSSCT00000002031
Sequence length 737
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:57896450:57969576:-1 gene:ENSSSCG00000001810 transcript:ENSSSCT00000002031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVAIADVQFGPMRFHPDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAHTVLACFL
DKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIIGVVRRVDRDESSVMSLIAAGFT
RRYVENPSLMACYNELLQLEFGEVRSQLKLRACNSVFAALEKSQEAIEITVKTTLYRYAN
PAFETTMGYQSGELIGKELAEVPINEKKADLLDTINSCIRIGKEWQGIYSARKKNGDNVQ
QNVKIIPVMGQGGKIRHYVSIIRVCNGNSKAEKITECVQSDTHTDNQTGKHKDRRKSSLD
VRTVASRASEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLEI
LRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKSLQQVSSSIITPISL
HDIPPRIARAMENEEYWDFDIFELEAATHKRPLIYLGLKTFARFGVCEFLNCSETTLRSW
LQIIEANYHSSNPYHNSTHAADVLHATAYFLCKERIKQTLDPLDEVAALIAATIHDVDHP
GRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGI
IDMVLATEMTKHFEHVNKFVNSINKPLAALEEDGETDKGQEAINTMLRTLENRTLIKRML
IKCADVSNPCRPLEQCIEWAARISEEYFSQTDEEKQQDLPVVMPVFDRNTCSIPKSQISF
IDYFITDMFDAWDGKNW
Download sequence
Identical sequences ENSSSCP00000001982 ENSSSCP00000001978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]