SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001993 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001993
Domain Number 1 Region: 85-651
Classification Level Classification E-value
Superfamily Urocanase 9.55e-224
Family Urocanase 0.0000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001993   Gene: ENSSSCG00000001823   Transcript: ENSSSCT00000002042
Sequence length 676
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:58628304:58665410:1 gene:ENSSSCG00000001823 transcript:ENSSSCT00000002042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLRALCSGLPLRPLPENRGRCAGVPHAPVRTPGLSPTEEQLALRNALRYFPPDVQEQL
APEFAQELRLYGHIYMYRFCPNLEMKAYPVEQYPCRTKAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMSYLSQMTEEQTLVMYSGHPLGLFPSSPGAPRLVITNGM
VIPNYSSRIEYEKLFAMGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAGRRYLGVEDLA
GKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDGAALRKRYQQGWLMEVTNSLDHCIERL
REARKRKEALSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLG
FAEAQSLMASDPAAFKGLVQESLRRHVSAINRLAQGNFFFWDYGNAFLLEAHRAGADVGK
PGASKMEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLAVTDHLATSVLEEAISGGV
NPAVKLQYMDNIRWIREAAKHQLVVGSQARILYSDQKGRVAIAVAFNQAIARGEIKAPVV
LSRDHHDVSGTDSPFRETSNIHDGSAFCADMAVQNFVGDAFRGATWVALHNGGGVGWGEV
INGGFGLVLDGTEEAEQKARMMLSWDVSNGVARRCWSGNRKAYEIICQTMQENSGLVVTL
PHEVTDEYMLQQALQA
Download sequence
Identical sequences A0A287BPN5
NP_001231148.1.46622 XP_020953765.1.46622 XP_020953766.1.46622 ENSSSCP00000001993 ENSSSCP00000001993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]