SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002056 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002056
Domain Number 1 Region: 634-1050
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.79e-93
Family alpha-mannosidase, C-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 262-529
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.02e-84
Family alpha-mannosidase 0.0081
Further Details:      
 
Domain Number 3 Region: 530-631
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.26e-24
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000002056
Domain Number - Region: 85-135
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00829
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002056   Gene: ENSSSCG00000001881   Transcript: ENSSSCT00000002106
Sequence length 1054
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:62936863:62949430:1 gene:ENSSSCG00000001881 transcript:ENSSSCT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHLGLSGKRGKRATMAAAPAVKHWRTTLERVEKFVSPVYFTDCNLRGRLFGDSCPVAELS
SFLTPERLPYQEAVQQDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLRWESDGE
GLVWRDGEPVQGLTKEGEKTSYVLTDRLGEEDPRSLTLYVEVACNGLLGAGKGSMIASPD
PEKMFRVSRAELAVFHQDVHKLLVDLELLLGIAKGLGEDNQRSFQALYTANQMVNVCDPA
QPETFSVAQALASKFFGQRGGESQHTIHAMGHCHIDTAWLWPFKETVRKCARSWVTVIQL
MERNPEFIFACSQAQQLQWVKSHYPGLHARLQEFACRGQFVPVGGTWVEMDGNLPSGEAM
VRQFLQGQNFFLQEFGKMCSEFWLPDTFGYSAQLPQIMRSCGIRRFLTQKLSWNLVNSFP
HHTFFWEGLDGSRVLAHFPPGDSYGMQGSVEEVLKTVTKNRDKGRTNHSAFLFGFGDGGG
GPTQTMVDRLKRLRDTDGLPRVQFSSPERLFSALETHSGQLCTWVGELFLELHNGTYTTH
AQIKKGNRECERILHDVELLSSLALARSAQFLYPAAQLQDLWRLLLLNQFHDVVTGSCIQ
LVAEEAMCHYEDIRSHGNTLLSAAAAALCAGEPGPEGLLIVNTLPWKRTEVLALPRPGGA
HSLALVTVPSMGYAPAPTPTSLQPPLPQQPVCVMQETDGSVTLDNGIIRVRLDPIGRLTS
LVLVASGREVIAEGTVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGG
VRGSAWFLLQISPSSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSPQATY
EVQFGHLQRPTHYNTSWDWARFEVWAHRWIDLSEHGFGLALLNDCKYGASVRGNVLSLSL
LRAPKSPDATADMGRHEFTYALMPHKGSFQDAGVIPAAYSLNFPLLALPAPGPAPAAAWS
AFSLSSPAVVLETVKQAEASPQGRTLVLRLYEAHGSHVDCWLHTSLPVQEAVLCDLLERR
DPSGPLPLRDARLKLTFSPFQVQSLLLVLQPPPN
Download sequence
Identical sequences ENSSSCP00000002056 ENSSSCP00000002056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]