SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002077 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002077
Domain Number 1 Region: 31-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-57
Family Lectin leg-like 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002077   Gene: ENSSSCG00000001899   Transcript: ENSSSCT00000002127
Sequence length 504
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:63406414:63418769:-1 gene:ENSSSCG00000001899 transcript:ENSSSCT00000002127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVVHGLDPLLSLLLILLLDPHSPEGGHPPQRRFEYKLSFKGPRLALPGAGIPFWSHHGD
AILGLEEVRLAPSMRNRSGAVWSRTPVLFPAWEVEVQMRVTGPGRLGAQGMAVWYTRGRG
QVSSVLGALDSGDSIGILFDSSAEDTQKSPAIRVLVGNGHNPDEPLGDGASRVLGSCHRA
FRNRPNPFRARITYWRQRLRLSLNSGLTPSDPDELCVDVGPLLLAPGGFFGVLAATSTLA
DDHDVLSFLTFSLSEPGPEPPPQPFLEMEQLRLARQLEGLRARLALGTKEDTILKPNSKV
QEEGERIFDLEETLDRYSQILQALQGLSKQLAQAERQWKKELGSTDCARPESTWDSAKVS
ALLRGQLTLLQDLQEMRDAAAHMASRAQVFYLPVGTKHHFLELAQILSLLQKDLRGPAKA
AAKDPRPPGWPPGIFSCLRPGIFLFFLLVQTVGFFCYVHFSKQELDKNLQDYLSTGSLPL
SPAPQISRALGALRRQPLYPNIHA
Download sequence
Identical sequences F1SJ28
ENSSSCP00000002077 9823.ENSSSCP00000002077 XP_001925484.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]