SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002122 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000002122
Domain Number - Region: 78-115
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0115
Family RILP dimerisation region 0.011
Further Details:      
 
Domain Number - Region: 32-73
Classification Level Classification E-value
Superfamily MoaD/ThiS 0.0203
Family ThiS 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002122   Gene: ENSSSCG00000001941   Transcript: ENSSSCT00000002173
Sequence length 141
Comment pep:known chromosome:Sscrofa10.2:7:67504659:67564944:-1 gene:ENSSSCG00000001941 transcript:ENSSSCT00000002173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLQLANEERDEAVARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNG
AIIVDRIYKTKECKKRITAEEMNAVIEERDAALSQCKRLEQELHHLKEQNQTSANNMRHL
TAENNQERALKVNLHSFLQAN
Download sequence
Identical sequences ENSSSCP00000002122 ENSSSCP00000002122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]