SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002160 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002160
Domain Number 1 Region: 19-246
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-71
Family Eukaryotic proteases 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002160   Gene: ENSSSCG00000001978   Transcript: ENSSSCT00000002212
Sequence length 248
Comment pep:known chromosome:Sscrofa10.2:7:79831197:79834605:-1 gene:ENSSSCG00000001978 transcript:ENSSSCT00000002212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLLLLLSLAFLLPPRAEAGEIIGGHEAKPHSRPYMAYLQIQDQDNRSRCGGFLIREDF
VLTAAHCWGSSINVTLGAHNIKKQEETQQVIPVRKAIRHPDYNEKRISNDIMLLQLERKA
KLTKAVKTLGLPGAKARVKPGQVCSVAGWGQVERGIYTDTLQEVKLTLQKDQECDSYLPN
YYNGNTQLCVGDPKKKQATFKGDSGGPLVCNNVAQGIVSYGKKDGTPPRACTKVSSFLPW
IKKIMKSL
Download sequence
Identical sequences B8XTR7
NP_001137182.1.46622 ENSSSCP00000002160 ENSSSCP00000002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]