SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002162 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002162
Domain Number 1 Region: 17-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.84e-69
Family Eukaryotic proteases 0.000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002162   Gene: ENSSSCG00000001979   Transcript: ENSSSCT00000002214
Sequence length 251
Comment pep:known chromosome:Sscrofa10.2:7:80046917:80049780:-1 gene:ENSSSCG00000001979 transcript:ENSSSCT00000002214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLLLLVALLPPPPGEAGKIIGGHEVTPHSRPYMAYSVSKTSGRTSVCGGFLVSTNFVL
TAAHCWGSSIKVTLGGHNIQEKEETQQVIPVKNAICHPDYDSKICANDIMLLQLMWAAKL
GPAVGLLKLPRYRELVMPGTVCSVAGWGRLGVNSPSATTLRETDVEVQRDEQCSGRFKYN
STIQICAGSPTKMNNSFLGDSGGPLVCKGVAQGIVSFGKKDGSPPSVYTKISSFLPWIKK
TMRNHTQQGPD
Download sequence
Identical sequences ENSSSCP00000002162 9823.ENSSSCP00000002162 ENSSSCP00000002162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]