SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002165 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002165
Domain Number 1 Region: 17-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-70
Family Eukaryotic proteases 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002165   Gene: ENSSSCG00000022894   Transcript: ENSSSCT00000002217
Sequence length 251
Comment pep:known chromosome:Sscrofa10.2:7:79812625:79816303:-1 gene:ENSSSCG00000022894 transcript:ENSSSCT00000002217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPVLLSLAFLLSPGLGWPFLAEEIIGGHEAKPHSRPYMAFVRFLDKESVKRCGGVLVRK
DFVLTAAHCRGSSINVTLGAHNIKKQEETQQVIPVRKAIRHPDYNEKRISNDIMLLQLER
KAKLTKAVKTLGLPGAKARVKPGQVCSVAGWGQVARGIQTSTLQEAKLRVQDDVACEFPF
PSGYYHRASQICVGNPRDMKTSFKGDSGGPLVCKNVVQGIFSYGKMDGTPPGVFTKVSHF
LPWIKKTMKPL
Download sequence
Identical sequences B8XTR8
ENSSSCP00000002164 ENSSSCP00000002165 NP_001137165.1.46622 ENSSSCP00000002164 ENSSSCP00000002165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]