SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002179 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002179
Domain Number 1 Region: 266-575
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-116
Family Transglutaminase core 0.0000000166
Further Details:      
 
Domain Number 2 Region: 114-263
Classification Level Classification E-value
Superfamily E set domains 7.7e-45
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 589-700
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.41e-30
Family Transglutaminase, two C-terminal domains 0.00051
Further Details:      
 
Domain Number 4 Region: 701-800
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002179   Gene: ENSSSCG00000001993   Transcript: ENSSSCT00000002231
Sequence length 828
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:80300797:80316056:1 gene:ENSSSCG00000001993 transcript:ENSSSCT00000002231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPTPPSGTTDGARSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRDGRSFWARCCGCCS
CRNTDDDWGPRGDRGAGSRDRGSGSGSRRPDSRGSDSRRPGSRGSGVNAAGDGTIREGML
VVKGVDLLSSRSDQNRREHHTDEFEYDELIIRRGQPFYMVLLLSRPYESSDYVALELLIG
NNPEVGKGTHIIIPVGKGGSGGWKAQVTKSSGQNLNLRVHTSPNAIIGKFQFTVRTRSEA
GEFQLPFNPRNEIYILFNPWCPDTEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTW
NYGQFDHGVLDACLYILDRRGMPYAGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSR
GTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTD
TSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFNGWQVVDATPQETSSG
IFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQNDGSFKIVYVEEKAIGTLIV
TKAIGSHMREDVTHIYKHPEGSEAERKAVETAAAHGSKPNVYATRDSAEDVAVQVEAQDA
VMGQDLTVCVVLTNRGGSRRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLEPGASERVTM
PVAYKEYQPHLVDQGAMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECE
VQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIA
SLDSPQLSQVHGVIQVDVAPAAGGGVFSDARGNSRSGETIPMASRGEA
Download sequence
Identical sequences ENSSSCP00000002179 ENSSSCP00000002179 9823.ENSSSCP00000002179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]