SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002556 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002556
Domain Number 1 Region: 29-517
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-144
Family ALDH-like 0.0000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002556   Gene: ENSSSCG00000002357   Transcript: ENSSSCT00000002621
Sequence length 534
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:103117991:103136318:-1 gene:ENSSSCG00000002357 transcript:ENSSSCT00000002621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVLAAAAVRARILQVSSKVNSSWHPASSFSSSSVPTVKLFIGGKFIESKSDKWIDIHN
PATNELIGRVPQATKAEMDAAVSSCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIAK
LITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCAG
IAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNVIHGQ
HEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKENT
LNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVERAKNLRVNAGDQPGADLGPLISP
QAKERVCNLIDSGTKEGASILLDGRNIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGP
VLVVLETDTLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPLPM
FSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences F1S3H1
XP_005656456.1.46622 ENSSSCP00000002556 ENSSSCP00000002556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]