SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002566 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002566
Domain Number 1 Region: 663-731
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-20
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 2 Region: 1579-1638
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-16
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 3 Region: 997-1146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000196
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 1412-1470
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000196
Family TB module/8-cys domain 0.00027
Further Details:      
 
Domain Number 5 Region: 895-1014
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 546-612
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000706
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 7 Region: 1731-1818
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 1185-1295
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000487
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 612-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000929
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 10 Region: 1130-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000038
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1302-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000796
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 12 Region: 1477-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 854-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1522-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000528
Family EGF-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000002566
Domain Number - Region: 185-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 396-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000492
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002566   Gene: ENSSSCG00000002368   Transcript: ENSSSCT00000002632
Sequence length 1821
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:103590368:103694062:-1 gene:ENSSSCG00000002368 transcript:ENSSSCT00000002632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSTTRRCPGRALRNPWRSFLPLTLALFVGLGHAQRDPVGRYEPAGRDANRLRRPGGSH
PAAAAAKVYGLFRDQDASVPGLPPEERAQPGWGSARRPAETEARRPPRAQQPRRVQPPAQ
TWRSRSLSQQQPASRDRAAAALPRLGTVQRPRAARGRLTGRNVCGGQCCPGWTTANSTNH
CIKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPEEEFDPQNSRPAPRRSAEGSPN
LRRSSAARESSTARMRPPAPQPPPASPERPGSKTLSRLSQTHPSQQHMGLSQTVRLYPAA
AASGQLTSNALPVGPGPERRDGAQQTAYVDHLSSPWGLNLTEKIKKIKIVFTPTICKQTC
AHGRCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTG
KFCHLPAPRLDPEPPERGPRHRTPLEGSLKQSTFTLPLSNQLASVNPSLVKVHIHHPPEA
SVQVHQVARVRGEAEGAPEENSVETRPSPRFPTGPGHSPWSSNSIPTRSREAPRPPPPAV
PRLRPLLGRCYLSAVNGQCANPLLELTAQEDCCGSVGAFWGVTSCAPCPPRPASPVIENG
QLECPQGYKRLNLTHCQDVNECLTLGLCEDSECVNTRGSYLCTCRPGLLLDPSRSRCVSD
KAVSMQQGLCYRLLGPGTCALPLAQRITKQICCCSRVGKAWGSKCETCPLPGTEAFREIC
PAGHGYTYSSSDIRLSMRKAEEEELARPSWEHVQKSHGTPPGPADRQPLRAATGTWLEAG
TIPDKGDTQAGQVTTSVTQLATWVPGDAIGRPTPSLPARGIPEAQEEEQVTAPTDVLVTP
APPAIDRCATGATNICGPGTCVNLPDGYKCICSPGYRLHPSQAYCTDDNECLRDPCKGRG
RCVNRVGSYSCFCYPGYMLATSGATQECQDIDECEQPGLCSGGRCTNTVGSYHCECDQGY
IMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLPCEEGYRGQSGSCVDVNECLTPGVC
AHGTCLNLEGSFRCSCEPGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFTCSACES
GYWVNEDGTACEDLDECAFPGVCPSGVCANTAGSFSCRDCEEGYRPSALGHTCEDVDECA
DPQSRCLGGECKNTAGSYQCLCPQGFQLTNGSVCEDVDECVGEEYCAPRGECLNSHGSFF
CLCAPGFASADGGTSCQDVDECAVTDRCLRGQCVNTEGSFNCLCETGFQPSPESEECVDI
DKCEDSGDSACGAWRCENSPGSHRCILGCQPGFHVAPAGDGIDIDECANDTVCGSHGYCD
NTEGSFRCLCDQGFETSASGWDCVDVNECELMLAVCGTALCENVEGSFLCLCANDLEEYD
AQEGHCRPRLAGGQSIPEASPGDRSPVPIRMECYSGQKGQPPCSSLLGRNTTQAECCCTQ
GTGWGDACDLCPAEDSVEFSEICPSGKGYVPVEGAWMFGQTTYTDADECVMFGHALCRNG
RCLNTVPGYICLCNPGYHYDASRHKCEDHDECQDMACENGECVNTEGSFHCFCSPPLTLD
LSQQRCVNSTSGLEDLPDHDIHTDICWKKVTNYVCSHPLHGRRTTYTECCCQDGEAWSQQ
CALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPEDLHYGLYGPEGAPFYNYL
GPEDAIPEPLFPNTVSRPEDHTLVLEPPLQPSELQPHYVASHPENQAGFEGLQAEECGIL
NGCDNGRCVRVREGYTCDCFEGFQLDTAQMACVDVNECDDLNGPAALCVHGHCENTEGSY
RCHCPPGYVAEAGPPHCTAKE
Download sequence
Identical sequences ENSSSCP00000002566 ENSSSCP00000002566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]