SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002607 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002607
Domain Number 1 Region: 121-162
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002607   Gene: ENSSSCG00000002405   Transcript: ENSSSCT00000002674
Sequence length 355
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:106746027:106752988:1 gene:ENSSSCG00000002405 transcript:ENSSSCT00000002674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDAPLLLELQKLPGLANTDLSAPNPNIQVTIEVVEDPQAEVEMDLMAEPSNRWPQGAPNW
LPTKELFWPLFWGYLEGEEGRTNVKGRAPGEEEEVEEEGYPPEYMVRPSDQDWVTNLNHE
LQEEWSPWSPCPGSCSGGSQRRTRPCGSACTATKSRACDLPPVLQPKSAVNHSLWIQLAG
GGTDVDSCEKWLNCKSDFLAKYLSQVLRDLPSCPCAYPLEVVYRAVSLPEERQGRSFRWR
DASGPRERLDVYQPTARFCLRSLLSLQSSTLAAQHCCYDAGSRLLTRGKGAAAPDLVSTD
ISPELHFKVDTLPWLLCKGDWSRYHAVRPPNNGRACADNPPEEEYLAQLQEAKEY
Download sequence
Identical sequences ENSSSCP00000002607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]