SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002616 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002616
Domain Number 1 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 1.22e-23
Family HCP-like 0.003
Further Details:      
 
Domain Number 2 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 1.77e-20
Family Fibronectin type II module 0.00085
Further Details:      
 
Domain Number 3 Region: 361-437
Classification Level Classification E-value
Superfamily HCP-like 0.000000000000759
Family HCP-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002616   Gene: ENSSSCG00000002414   Transcript: ENSSSCT00000002683
Sequence length 442
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:110402805:110446103:-1 gene:ENSSSCG00000002414 transcript:ENSSSCT00000002683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVGVRLTLLLCVVLLGSASVSSDEEGDQDESLDSKTSLPSDESVKDHSPTGRVVAGQLF
LESEESEVESPIQEEEDSLRSQEGESVAEEINFLESPNPENRDYEEPTKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLSQNIQ
AAKGMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKVL
YSSSTIYQKKLKAITHFSVQFF
Download sequence
Identical sequences ENSSSCP00000002616 ENSSSCP00000002616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]