SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002645 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002645
Domain Number 1 Region: 171-299
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.16e-19
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 15-70,112-169
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000002645
Domain Number - Region: 286-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000869
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002645   Gene: ENSSSCG00000002444   Transcript: ENSSSCT00000002714
Sequence length 448
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:120031685:120114530:-1 gene:ENSSSCG00000002444 transcript:ENSSSCT00000002714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APHLQRILTATILALCLPSPGDAQQQCTNGFDLDRSSGQCLDIDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSNPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMD
ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELED
DGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPAGYILMDDNRSCQDINECEHRNHTCI
LQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF
Download sequence
Identical sequences ENSSSCP00000002645 ENSSSCP00000002645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]