SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002672 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002672
Domain Number 1 Region: 8-232
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.65e-70
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.0000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002672   Gene: ENSSSCG00000002469   Transcript: ENSSSCT00000002741
Sequence length 234
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:122163461:122182984:1 gene:ENSSSCG00000002469 transcript:ENSSSCT00000002741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETPFNLISEKCDILSILRDHPENRIYQRKIQELSKRFTAIRKTKGDGNCFYRALGYSY
LESLLGKSREILKFKERVLQTPNDLLAAGFEEHKFQNFFNAFYSVVELVEKDGSVSSLLK
VFNDQSSSDRIVQFLRLLTSAFIRNRADFFRHFIDEEMDIRDFCTHEVEPMAMECDHIQI
TALSQALNIALQVEYVDEMDTALNHHVFPEAAIPSVYLLYKTSHYNILYAADKR
Download sequence
Identical sequences F1SCG8
XP_001925403.1.46622 ENSSSCP00000002672 ENSSSCP00000002672 9823.ENSSSCP00000002672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]