SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002768 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002768
Domain Number 1 Region: 423-551
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000235
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 2 Region: 359-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000251
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 3 Region: 610-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000839
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 763-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000594
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 727-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 597-723
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000011
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 7 Region: 801-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000147
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 323-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 281-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000002768
Domain Number - Region: 844-885
Classification Level Classification E-value
Superfamily FnI-like domain 0.000691
Family VWC domain 0.074
Further Details:      
 
Domain Number - Region: 399-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002768   Gene: ENSSSCG00000002555   Transcript: ENSSSCT00000002840
Sequence length 1018
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:131225912:131245242:-1 gene:ENSSSCG00000002555 transcript:ENSSSCT00000002840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTG
PCNYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIV
EAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELKIRVRCDENYYSAT
CNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCAVPGECRCSY
GWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCNKDLNYCGSHHPCTHGGTCINA
EPDQYRCVCPDGYSGRNCERAEHACASNPCANGGSCHEVPSGFECHCPAGWSGPTCALDI
DECASSPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYY
CDCVPGWMGVNCHININDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCERELDECASSP
CHGGFCQDLVDGFRCHCPQGFSGPLCEVDIDFCEPSPCQNGAPCYNLEGDYYCACPDHVS
GKNCSELREPCPGGACRVVDGCGLEPGTRVAGGVAPSSVCGPHGHCVSQPGGNFSCVCDS
GFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSR
GRCYDLVNDFYCACDDGWKGKTCHSRESQCDAYTCGNGGTCYDSGDTFRCACPPGWRGST
CNIAKNSSCLPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGVCVD
GVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVM
VFGRSCWSQGVPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGRKPCLLAGRSAALNAQCPP
GQRCQEKAPGQCLQPPCAAWGECGAEEALLPSTPCRPRSGHLDNNCARLTLRFNRDQVPQ
GTTVGAICSGIRALPATRAVARDRLLVLLCDRPSSEASAVEVALVSGEWGPSSSRVPL
Download sequence
Identical sequences ENSSSCP00000002768 ENSSSCP00000002768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]