SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002770 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002770
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Nudix 8.71e-22
Family MutT-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002770   Gene: ENSSSCG00000002557   Transcript: ENSSSCT00000002842
Sequence length 176
Comment pep:known chromosome:Sscrofa10.2:7:131249482:131253801:-1 gene:ENSSSCG00000002557 transcript:ENSSSCT00000002842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNASRRSLVLVKQFRPAVYAGAVERLFPGSLVAADQDRPRELPAALPGSAGVTFELCAG
LVDQPGLSLEEVACKEAWEECGYRLAPSDLRRVASYKSGVGLTGSSQTMFYAAVTDAQRG
GPGGGLAEEGELIEVVHLPLDGAQAFADDPDVPKTLGVIFGISWFLSCVAPVLGPQ
Download sequence
Identical sequences ENSSSCP00000002770 ENSSSCP00000002770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]