SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002882 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002882
Domain Number 1 Region: 14-305
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-55
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002882   Gene: ENSSSCG00000002670   Transcript: ENSSSCT00000002961
Sequence length 309
Comment pep:novel chromosome:Sscrofa10.2:6:4473347:4490418:-1 gene:ENSSSCG00000002670 transcript:ENSSSCT00000002961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKLLSPD
NEKLTVSNGPQSHLVDEDEQEEPGEGSEDEWEQVGPRNKTSVTRQADFVQTPITGIFGGH
IRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEI
SRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKNKNFKCH
RTYRLFAVVYHHGSSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPAAERTAYL
LYYRRVDLL
Download sequence
Identical sequences ENSSSCP00000002882 ENSSSCP00000002882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]