SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002978 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002978
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.47e-43
Family Nip7p homolog, N-terminal domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002978   Gene: ENSSSCG00000002760   Transcript: ENSSSCT00000003057
Sequence length 180
Comment pep:known chromosome:Sscrofa10.2:6:16587551:16592245:-1 gene:ENSSSCG00000002760 transcript:ENSSSCT00000003057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLMSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences Q56P27
9823.ENSSSCP00000002978 ENSSSCP00000002978 ENSSSCP00000002978 NP_001041536.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]