SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003039 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003039
Domain Number 1 Region: 316-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-28
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 155-305
Classification Level Classification E-value
Superfamily ARM repeat 0.000000576
Family HspBP1 domain 0.083
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily RING/U-box 0.00000127
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003039   Gene: ENSSSCG00000002820   Transcript: ENSSSCT00000003120
Sequence length 576
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:17159491:17195722:1 gene:ENSSSCG00000002820 transcript:ENSSSCT00000003120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGWAVFLVSRSLGQGLLLTLEEHIAHFLGTRGATATMGNSCICRDDSGAEDAVDTQQ
QQAENSAVPTADTRNQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSGHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLITLESWADDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVDLNSIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDAGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHLHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
KPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVSRVRQISHIS
Download sequence
Identical sequences F1RF31
ENSSSCP00000003039 XP_020949565.1.46622 XP_020949566.1.46622 9823.ENSSSCP00000003039 ENSSSCP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]