SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003049 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003049
Domain Number 1 Region: 462-660
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.02e-68
Family Hemopexin-like domain 0.00000000187
Further Details:      
 
Domain Number 2 Region: 89-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.23e-36
Family Matrix metalloproteases, catalytic domain 0.00000042
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 2.11e-21
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 4 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-21
Family Fibronectin type II module 0.000072
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-20
Family Fibronectin type II module 0.000069
Further Details:      
 
Domain Number 6 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003049   Gene: ENSSSCG00000002829   Transcript: ENSSSCT00000003130
Sequence length 660
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:27526398:27553927:-1 gene:ENSSSCG00000002829 transcript:ENSSSCT00000003130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARGARGALAGPLRRCVLGCLLSRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWD
KTQITYRIIGYTPDLDPETVDDAFARAFRVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFSFN
GKEYNSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKH
ESCTSAGRSDGKLWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGAL
MAPIYTYTKNFRLSHDDVKGIQELYGASPDIDTGTGPTPTLGPVTPEICKQDIVFDGISQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences ENSSSCP00000003049 ENSSSCP00000003049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]