SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003057 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003057
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000000491
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003057   Gene: ENSSSCG00000002837   Transcript: ENSSSCT00000003138
Sequence length 201
Comment pep:known chromosome:Sscrofa10.2:6:30401961:30415967:1 gene:ENSSSCG00000002837 transcript:ENSSSCT00000003138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYEDPDISAGKIKQ
FCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAF
VKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCA
RRLLCDAYMCMYQSPTMSLYK
Download sequence
Identical sequences ENSSSCP00000003057 ENSSSCP00000003057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]