SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003203 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003203
Domain Number 1 Region: 414-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-19
Family SPRY domain 0.039
Further Details:      
 
Domain Number 2 Region: 14-144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000897
Family SPRY domain 0.082
Further Details:      
 
Domain Number 3 Region: 3384-3462
Classification Level Classification E-value
Superfamily EF-hand 0.00000907
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 4 Region: 767-891
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000091
Family SPRY domain 0.033
Further Details:      
 
Domain Number 5 Region: 1531-1601
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000107
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003203
Domain Number - Region: 1942-2060,2251-2414,2471-2530
Classification Level Classification E-value
Superfamily ARM repeat 0.0184
Family Pumilio repeat 0.059
Further Details:      
 
Domain Number - Region: 3846-3860,4032-4052
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.041
Further Details:      
 
Domain Number - Region: 2329-2414,2472-2710,2764-2789,2841-2861,3209-3233,3289-3383
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family Armadillo repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003203   Gene: ENSSSCG00000002961   Transcript: ENSSSCT00000003285
Sequence length 4370
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:42840240:42960106:1 gene:ENSSSCG00000002961 transcript:ENSSSCT00000003285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDEVVPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHV
PRLVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLNGLFFPVVSFSAG
VKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLRLEPIKEYRREGPRGPHLVGPSRCL
SHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPC
LVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLRKTKLPKTYMMSNGYK
PAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRL
LDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVESQSRWDRVRIFRAEKSYAVQSG
RWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSELFGRPWQSG
DVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEVGDGFLPVCSLGPGQVGHLNLGQ
DVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVSRVDGTVDT
PPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAEDEARAA
EPDPDYENLRRSAGRWGEAEGGKEGTAKEGAPGGTAQAGVEAQPPRAENEKDATTEKNKK
RGFLFKAKKAAMMTQPPATPTLPRLPHEVVPADDRDDPDIILNTTTYYYSVRVFAGQEPS
CVWVGWVTPDYHQHDMNFDLTKVRAVTVTMGDEQGNIHSSLKCSNCYMVWGGDFVSPGQQ
GRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFEL
GKQKNIMPLSAAMFLSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLRVETRRAGERLGW
AVQCQEPLTMMALHIPEENRCMDILELSERLDLQQFHSHTLRLYRAVCALGNNRVAHALC
SHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAIT
LFPPGKRTENGPRRHGLPGVGVTTSLRPPHHFSAPCFVAALPAVGAAEAPARLSPSIPLE
ALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKM
IEPEVFTEEEEEEEEEEEEEEEDEEEKEEDEEEEAREKEDEEKEEEETAEGEKEEYLEEG
LLQMKLPESVKLQMCNLLEYFCDQELQHRVESLAAFAERYVDKLQANQRDRYGILMKAFT
MTAAETARRTREFRSPPQEQINMLLHFKDGEDEEDCPLPDEIRQDLLEFHQDLLTHCGIQ
LEGEEEEPEEEATLGSRLMSLLEKVRLVKKKEEKSEEEPPAEESKPQSLQELVSHTVVRW
AQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLGQIRSL
LIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRF
PKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNE
LALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGES
VEENANVVVRLLIRKPECFGPALRGEGGSGLLATIEEAIRISEDPARDGPGVRRDRRREH
FGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDD
LVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVG
FLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHT
VYRLSRGRSLTKAQRDVIEECLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLT
NHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAMPCLCA
IAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEK
WAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEK
AREGEEEKTEKKKTRKISQSAQTYDAREGYNPQPPDLSGVTLSRELQAMAEQLAENYHNT
WGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDME
LDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLAEAVVSSGRVEKSPHEQEIKFFAKILLP
LINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAV
VNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKG
VGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVE
KLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCPDIP
VLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPPC
TAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGR
LRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAHWL
TEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGS
DQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQELITLAKTRYALKDTDEEV
REFLQNNLHLQGKVEGSPSLRWQMALYRGLPGREEDADDPEKIVRRVQEVSAVLYHLEQM
EHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHSF
EDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIM
AKSCHLEEGGENGEAQEEVEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISACKGET
GAMVSSTLKLGISILNGGNADVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQ
NKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNT
TTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQ
GPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSL
LEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISK
KDFQKAMDSQKQFTGPEIQFLLSCSEADENEMIDCEEFANRFQEPARDIGFNVAVLLTNL
SEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQV
KESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEPEEDEDEGAGLAE
AGAEGAEEGAVGPEGAAGTAAAGLTARLAAATSRALRGLSYRSLRRRVRRLRRLTAREAA
TALAALLWAALAHAGAAGAGAAAGALRLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTGD
EVHGEQPAGPGGEADGEGAGEGAGEALEGAGDEEVAVQEAGPGGADGAVAVAEGGPFRPE
GAGGLGDMGDTTPAEPPTPEGSPIIKRKLGVDGEEEELPPEPEPEPEPEPEKADAENGEK
EEVPKPPPEPPKKTAPPPPPPKKEEGGSGGLEFWGELEVQRVKFLNYLSRNFYTLRFLAL
FLAFAINFILLFYKVSDSPPGEDDMEGSAAGDLSGAGSGGGSGWGSGAGEEVEGDEDENM
VYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLY
ITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAELLGMDLAT
LEITAHNERKPEPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNF
FFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSE
DEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVI
LLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLAN
YMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences ENSSSCP00000003203 ENSSSCP00000003203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]