SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003209 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003209
Domain Number 1 Region: 8-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.5e-121
Family Calpain large subunit, catalytic domain (domain II) 0.0000000136
Further Details:      
 
Domain Number 2 Region: 354-531
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.96e-40
Family Calpain large subunit, middle domain (domain III) 0.0000406
Further Details:      
 
Domain Number 3 Region: 547-713
Classification Level Classification E-value
Superfamily EF-hand 7.78e-23
Family Penta-EF-hand proteins 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003209   Gene: ENSSSCG00000002967   Transcript: ENSSSCT00000003291
Sequence length 718
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:43126597:43139771:-1 gene:ENSSSCG00000002967 transcript:ENSSSCT00000003291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGSRRVTIQLVNEEAEPGTKGPKPFRGQSYRAIQAACLDEGILFRDPYFPAGPDALGY
DQLGPDSEKAKGVEWKRPHEFCAEPQFICEDMSRTDVCQGSLGNCWFLAAAASLTLYPRL
LCRVVPPGQGFQDGYAGVFHFQLWQFGHWVDVVVDDRLPVREGKLVFVHSAQRNEFWAPL
LEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNASGLFAALRHALAKESLVGA
TALSDRGEYRTGDGLVKGHAYSVTGTHKVSLGFTKLRLLRLRNPWGRVEWTGAWSDSCPR
WDELPTEWRDALLVRKEDGEFWMELQDFLCHFDTVQICSLSPEVLGPSPAGGGWHIHTFQ
GRWVRGFSSGGSQPGAETFWTNPQFRLTLLEPDEEDEDEEGPWGGWGATGSRGPTQGGRN
PKCTVLLSLIQRNRRRLRAQGLMYLTVGFHVFQIPEELLGLWDSPRSRALLPSLLRADRS
PFCARRDVSRRCRLRPGHYLVVPSTARAGDEADFTLRVFSERRHTAMEIDDVISADLHAL
MVPDISLEEGFEQVFQEPSREEEELRAPQLQTLLSIALEPARAHAWTPREIGLRTCEQLL
RCFGHGRSLALYHFQQLWGHLLEWQATFDKFDEDASGTMNSYELRLALNAAGFHLNNQLT
QALTSRYRDSRLRVDFERFVSCMAQLLCLFRHCSQHLDGGEGVICLTHRQWMEVATFS
Download sequence
Identical sequences ENSSSCP00000003209 ENSSSCP00000003209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]