SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003232 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003232
Domain Number 1 Region: 8-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-38
Family Galectin (animal S-lectin) 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003232   Gene: ENSSSCG00000002983   Transcript: ENSSSCT00000003314
Sequence length 138
Comment pep:known chromosome:Sscrofa10.2:6:43943595:43948406:1 gene:ENSSSCG00000002983 transcript:ENSSSCT00000003314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQVPYTKHVSLPVGSSVTIRGKPAVCFSKNPEMQVDFHTEADGDSDIAFHFRVSFGL
YVRMNSRQNGSWNCEVKSSDMPFADGQPFELHILVLQNEYQVMVNGQHYYSFPHRLSPQS
VKLMQVWRDVSLSSVCVC
Download sequence
Identical sequences B7U2G5
9823.ENSSSCP00000003232 ENSSSCP00000003232 NP_001136313.1.46622 ENSSSCP00000003232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]