SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003272 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003272
Domain Number 1 Region: 1504-1769
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-39
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 211-497
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-38
Family Kelch motif 0.0036
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1211-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 5 Region: 1074-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1163-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 7 Region: 2120-2250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000282
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003272
Domain Number - Region: 2292-2315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 1300-1401
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0131
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 
Domain Number - Region: 509-535
Classification Level Classification E-value
Superfamily Kelch motif 0.0327
Family Kelch motif 0.025
Further Details:      
 
Domain Number - Region: 2472-2482
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0602
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003272   Gene: ENSSSCG00000003021   Transcript: ENSSSCT00000003355
Sequence length 2789
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:45467631:45512743:-1 gene:ENSSSCG00000003021 transcript:ENSSSCT00000003355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRALAAALALSLAALGPLFLGAQAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPLPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCRSHGQCQPPGVCVCEPGWGGPDCSLQECQAYCGS
HGTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPPG
LLAVFGGQDLNRALGDLVLYNFSANTWERWDLTPAPAARHSHVAVAWAGSLVLMGGELAD
GSLTNDVWAFSPLGGGHWELLAPPASSSSGPPGLAGHAAALVDNIWLYVSGGRTQHDLFS
SGLFRFRLNSTSRGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRV
NSTELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL
MAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAALPPGTPSGACPAA
SCLGLGRLLGDCQACLAFSSTAAPPRGPGALGWCVHNESCLPRPEQARCRGEQISGTVGW
WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDKVLIVRSTTITLTPSAETDVSL
VYRGFIHPLLPGGPGGPGAEDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAQQEKET
RRLQRPGSARLFPLPGRGHKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFL
EPYRSSACASYSSCLGCLADQGCGWCLTSSTCHLRQSGAHCGDDGAGGSLLVLVPALCPL
CEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCDDCL
ANSSQCAWCQSTHTCFMFAAYLARYPHGGCRGWDDSVHSEPRCRSCDRFLTCHECLQSHE
CGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLSVALPARWAYARCPDVDECRL
GLARCHLRATCLNTPLSYECHCQRGYQGDGITYCNRTCLEDCGHGVCSGPPDFTCVCDLG
WTSDLPLPTPAPGPPAPRCSRDCGCNFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFG
NATGSGGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCF
RECGGRALLTNVSSVALGSRRVGGLLPAGGGAARAGPGLSYCVWVVSATEVLQPCAPGTL
CPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVIQSDRSLIAAFCGQRRDRPLTVQAL
SGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGVTGAGLCQCPQGWA
GPHCRMALCPENCNAHNGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLS
ADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGG
PGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVARDFWVLNLTTLQWRQEKAPQTVELPAV
AGHTLTPRRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYH
EATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDT
MVVLGGRSDPDEFSSDVLLYQVNCNTWLLPDLIRPASVGPPMEESVAHAVAAVGGRLYIS
GGFGGVALGRLLALTLPPDSCRLLPSPEACNQSGACIWCHGACLSGDQAHRLGCGGSPCS
PMPHSPEECRRLRTCSECLARHPRTLQPGDGEAPAPRCKWCTNCPEGACIGRNGSCTSEN
DCRINQREVFWAGNCSEAVCGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTC
FSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPS
YLPLRCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGSQDGGGHCLEGGLS
GPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDRPHGYECSCKTGYTMDNVT
GLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCHNH
TKGSHCEQCLPLFVGSAVGGGTCRPCHAFCRGNSHVCLSRKELEMARREPEKYSLDPDKI
ENWVSEGPSEDEAVCVNCQNNSYGDKCESCLHGYFLLEGKCTKCQCNGHADTCNEQDGTG
CPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPT
SQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVA
PDTGVHTVHIQPPPPPPPPPPPADGGPRGAGDLGGPGTGGGPATPVEPRVREVWPRGLIT
YVTVTEPSAVLVVRGVRDRLVITYPHEYHTLKSSRFYLLLLGVGDPSGPSANGSADSQGL
LFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRP
FAKVTVCFPPDPTAPALAWKPAGLPPPTFRRSEPFLAPLLLTGAGGPWGPVGGGCCPPAI
PATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGG
GGGAGGSGHGAGAGRKGLLSQDNLTSMSL
Download sequence
Identical sequences F1RGK2
ENSSSCP00000003272 XP_005655931.1.46622 ENSSSCP00000003272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]