SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003291 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003291
Domain Number 1 Region: 33-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.11e-36
Family L-arabinose binding protein-like 0.012
Further Details:      
 
Domain Number 2 Region: 640-791
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-30
Family Phosphate binding protein-like 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003291   Gene: ENSSSCG00000003038   Transcript: ENSSSCT00000003374
Sequence length 981
Comment pep:novel chromosome:Sscrofa10.2:6:45775123:45816245:-1 gene:ENSSSCG00000003038 transcript:ENSSSCT00000003374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCDASTYPGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKARQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILEETLAVKARGRDEASGTENSDKLVFHRLRQITQSRKFNYKLSLPKSGGKLHSLAEPQ
GRWDMTGAINTQPFYKVSMFLSLSLAERALYGFTFKILVVDIQLIYNAVLVSGVQFFSFY
FPFPPLFFRFSLFSQIPSLLAFLPTFLLPSEPRPCRRCSLPHAWENRGLGRPCSPPTQTN
CVWTALSRFWAPFKTFWPQSLSLLDVGSLRWAFTLIIISSYTANLAAFLTVQRMEVPVES
ADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLN
SRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNR
LEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSA
ESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAG
AGGDAGGAPLCPQRPLDNSVLPGAYLLLLTVLVCQECRRIQALRASGAGAPPRGLGAPAE
ATSPPRPRPGPAGPRELAEHE
Download sequence
Identical sequences ENSSSCP00000003291 ENSSSCP00000003291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]