SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003356 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000003356
Domain Number - Region: 253-306
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000706
Family RILP dimerisation region 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003356   Gene: ENSSSCG00000003100   Transcript: ENSSSCT00000003439
Sequence length 517
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:47556754:47579331:1 gene:ENSSSCG00000003100 transcript:ENSSSCT00000003439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPAGLQVDYVFRGVEHAVRVMVSGQVLELEVEDRMTADQWRGEFDASFIEDLTHKTGN
FKQFNIFCNMLESALMQSSESVTLDLLTYTDLESLRNRKMGGRPGSLASRSAQLNSKRYL
ILIYSVEFDRIHYPLPLPYQGKPDPVVLQGIIRSLKEELSRLRGLDGQDTRDSRETEIWH
LREQVSRLASEKRELEAQLGRSREEALAGRAARQEIEALRGLVRSLELELRQERGLGHRG
SGRRSQDCRRLAKELEEVKASERSLRARLKTLNTELATYKRGRRTPPVVPPSAREHRTST
SRERSTSRGRGATRSSSRESGRGGRGRGGPAGPSPSPTGGRVPRFDPTAFVKAKEKKQRE
IKRKQQQQQQQQQRNRLGSGGSGDGPSISWSRQTRPPATVTGRGDAANRSRNRSSSVDSF
RSRCSSASSCSEFEDFSESLPRGRRGKPPSPTTWSGSNTQQKSIPLERSRHQRRLASSGG
WVPMKEYSSDHQAADMAEIDARLKALQEYMNRLDTRS
Download sequence
Identical sequences A0A287B162
ENSSSCP00000003356 XP_005664670.1.46622 ENSSSCP00000003356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]