SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003357 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003357
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.9e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000711
Further Details:      
 
Domain Number 2 Region: 92-145
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000406
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003357
Domain Number - Region: 15-69
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000209
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003357   Gene: ENSSSCG00000003101   Transcript: ENSSSCT00000003440
Sequence length 670
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:47607503:47631684:1 gene:ENSSSCG00000003101 transcript:ENSSSCT00000003440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVNSAHALRSSTELRKEKSRDAARSRRSQETELYQLAHTLPFARGVSAHLDKASIMRLTI
SYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQ
LELIGHSIFDFIHPCDQEELQDALTPRQSLSKKKPEAPTERCFSLRMKSTLTSRGRTLNL
KAATWKVLHCSGHMRAYKPPSQTSPAGSPGPNLEPPLQCLVLICEAIPHPDSLEPPLGRG
AFLSRHSLDMKFTYCDERIAEVAGYRPDDLIGCSAYEYIHALDSDAVGQSIHALLSKGQA
VTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETEVVLSLEQTERH
SRRPIQRGTPSQEDAPNPGDSLDTSGPRILAFLHPPTLSEAALAADPRRFCSPDLRRLLA
PILDGTSVAATPSAPPATRCPQSPLPADLPDELLADVENAHKFFASGKDLDAVETDLDIA
QDADALDLEMLAPYISMDDDFQLNSSEQLPRAYHRLSGAVPRPRARSFHGMSPPTPEPTL
LPRWGSDPRLSCSSPSRGVPSAASPMAGARKRALAQSSEDEAEGVELLGVRPPKRSPSPE
PENFLLPPLSLSFLLTGGPAPGSRQDPGTHLLELNEPLGLGPSLLSLSRDEDAAQSRSHF
QPAADLAQAH
Download sequence
Identical sequences ENSSSCP00000003357 ENSSSCP00000003357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]