SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003364 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003364
Domain Number 1 Region: 312-398
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000353
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000956
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000654
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003364   Gene: ENSSSCG00000003108   Transcript: ENSSSCT00000003447
Sequence length 598
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:48231317:48248198:1 gene:ENSSSCG00000003108 transcript:ENSSSCT00000003447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPSSGGGGEVRCGGGRGGSVPWDFLPGLVVKAPPGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRTAGPPASLA
PGRRGPVALVSEIFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRAPTSGPPTPPSVPSSSSSSSSSSSFADTPEIVSAPEASP
TEMSPSSRVQERSFFIRMKSTLTKRGLHVKASGYKVIHVTGRLRARALGLVALGHTLPPA
PLAELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQS
HLDLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAVSGKSPGERHVLWVSYVLSQAEAGET
PLDAFQLPASLACEDASSPEPEPTEPEPPVEGKQAAPREEEEAPQPRGKAIKMEPSPQEP
EDREDSGDEEPSGHLAPPRPEFTSVIRAGALKQDLVGPWSLTPPGDPPPSLLHTGFLPPV
MRGLCAPGTIRYGPAELGLVYPHLQRLGPGPALPEAFYPALGLPYPGPLGTRVQRKGD
Download sequence
Identical sequences ENSSSCP00000003364 ENSSSCP00000003364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]