SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003381 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003381
Domain Number 1 Region: 148-198
Classification Level Classification E-value
Superfamily Kringle-like 1.54e-18
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 2 Region: 32-90
Classification Level Classification E-value
Superfamily Kringle-like 2e-18
Family Fibronectin type II module 0.0042
Further Details:      
 
Domain Number 3 Region: 1-44
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000183
Family Fibronectin type II module 0.0029
Further Details:      
 
Domain Number 4 Region: 102-142
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000183
Family Fibronectin type II module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003381   Gene: ENSSSCG00000003123   Transcript: ENSSSCT00000003464
Sequence length 198
Comment pep:novel chromosome:Sscrofa10.2:6:49131065:49151552:-1 gene:ENSSSCG00000003123 transcript:ENSSSCT00000003464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCVFPFYYRDGLFHDCVKFKAKHKWCSLNGTYRGYWKYCSEEDFARCVFPFWYRHLIYWE
CTSDGDAFGKMWCSLTQNYNKDKVWKYCEETESEGGHSCCSSCVFPFEYGDQLHHNCIWV
HSDYAWCSIDQKFQGRWRYCTARVLLLLLFSADPPRCIFPFLYRNKLFHRCTREGFVLSR
SWCSLTENYDQDGKWKQC
Download sequence
Identical sequences ENSSSCP00000003381 ENSSSCP00000003381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]